Bioinformatics Education Dissemination: Reaching Out, Connecting and Knitting-together

TRP Cage Problem Space
Sequence Data

Database and ID Label
Protein
Compound
Sequence
PDB:
1L2Y
Trp Cage (tc5b) NLYIQWLKDGGPSSGRPPPS
PDB: 1D0R GLP1-(7-36)-amide HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
PDB: 1JRJ Exendin-4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
PDB: 1FJR Methuselah ectodomain DILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVARHIRGCVCKLKPCVRFC CPHDHIMDNGVCYDNMSDEELAELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPCDGMFYLDNREEQDK YTLFENGTFFRHFDRVTLRKREYCLQHLTFADGNATSIRIAPHNCLIV

Alpha helices are essential elements of protein structure.  Helix configuration can reveal important insights into the structure and function of proteins. The helical wheel is a useful device for studying alpha helices.  The 'wheel' is a view along the elongated axis of the helix, with numbered positions and residues indicated. The colors of the residues in the wheel indicate the nature of each residue (nonpolar; polar uncharged; acidic; or basic). 

 

 

Sequences for Further Exploration

Database and Accession Label
Protein
Compound and Source
More Information
SWISSPROT:EXE3_HELHO Exendin-3 [ Heloderma horridum horridum (Mexican beaded lizard)]

Swiss-Prot

EXE3_HELHO, Primary accession number P20394, 39aa

“HorridumAngeli” Reptiles

GBVRT:49522381 & 49522382 glucagon [ Xenopus tropicalis (Pipid frog)]

Genbank

Genbank 49522381:
Xenopus tropicalis
glucagon, mRNA, 1360 bp

Genbank 49522382:
Glucagon [ Xenopus tropicalis ], 266aa

Xenopus tropicalis
Amphibian Model for Vertebrate Development Genetics

SWISSPROT:EXE2_HELSU Exendin-2 [ Heloderma suspectum (Gila monster)]

Swiss-Prot

EXE2_HELSU, Primary accession number P04204, 36aa

Stewart, M. 2003. "Heloderma suspectum" (On-line), Animal Diversity Web. Accessed January 10, 2005

SWISSPROT:GLUM_ANGAN

Glucagon-like peptide (GLP)

[ Anguilla anguilla (European freshwater eel)]

Swiss-Prot

GLUM_ANGAN , Primary accession number P63294, 30aa

European Eel (Anguilla anguilla) Behaviour & Migration Study

TrEMBL1:Q6PPF4

 

Glucagon (Fragment) [ Capra hircus (Goat)]

TrEMBL

TrEMBL: Q6PPF4, Glucagon (fragment), 45aa

Australian Gov. Dept of the Environment and Heritage

 

 

 

Copyright ©1988-2015     BioQUEST, Inc.     Madison, WI 53744   (608) 363-2012 All Rights Reserved.